missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Connexin 40/GJA5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£385.00 - £587.00
Specifications
| Antigen | Connexin 40/GJA5 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18344663
|
Bio-Techne
NBP3-17079-25UL |
25 μg |
£385.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18303042
|
Bio-Techne
NBP3-17079-100UL |
100 μg |
£587.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descripción
Connexin 40/GJA5 Polyclonal antibody specifically detects Connexin 40/GJA5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Especificaciones
| Connexin 40/GJA5 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cardiovascular Biology, Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| PBS, pH 7.2, 40% glycerol | |
| 2702 | |
| IgG | |
| Affinity purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| alpha 5, 40kD (connexin 40), connexin-40, Cx40, gap junction alpha-5 protein, gap junction protein, alpha 5, 40kDa, gap junction protein, alpha 5, 40kDa (connexin 40), MGC11185 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPG | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto