Connexin 40/GJA5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Bio-Techne NBP3-17079-100UL

Product Code. 18303042

Description

Connexin 40/GJA5 Polyclonal antibody specifically detects Connexin 40/GJA5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Connexin 40/GJA5
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: alpha 5, 40kD (connexin 40), connexin-40, Cx40, gap junction alpha-5 protein, gap junction protein, alpha 5, 40kDa, gap junction protein, alpha 5, 40kDa (connexin 40), MGC11185
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPG
• Quantity: 100 μg
• Research Discipline: Cardiovascular Biology, Cell Biology, Cytoskeleton Markers, Signal Transduction
• Gene ID (Entrez): 2702
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified