missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Connexin 31/GJB3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£161.00 - £368.00
Specifications
| Antigen | Connexin 31/GJB3 |
|---|---|
| Dilution | Western Blot 1:2000-1:50000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18664890
|
Novus Biologicals
NBP2-92421-0.02ml |
0.02 mL |
£161.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18673440
|
Novus Biologicals
NBP2-92421-0.1ml |
0.1 mL |
£368.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Connexin 31/GJB3 Polyclonal antibody specifically detects Connexin 31/GJB3 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| Connexin 31/GJB3 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cytoskeleton Markers, Neuroscience, Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 2707 | |
| IgG | |
| Affinity purified |
| Western Blot 1:2000-1:50000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| connexin 31, connexin-31, Cx31, CX31MGC102938, DFNA2, DFNA2B, EKV, erythrokeratodermia variabilis, FLJ22486, gap junction beta-3 protein, gap junction protein, beta 3, 31kD (connexin 31), gap junction protein, beta 3, 31kDa, gap junction protein, beta 3, 31kDa (connexin 31) | |
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Connexin 31/GJB3 (NP_076872.1). ERERRHRQKHGDQCAKLYDNAGKKHGGLWWTYLFSLIFKLIIEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVDCYIARPTEKKIFTYFMVGASAVCIV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title