Connexin 31/GJB3 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92421-0.02ml

Product Code. 18664890

Description

Connexin 31/GJB3 Polyclonal antibody specifically detects Connexin 31/GJB3 in Human, Mouse, Rat samples. It is validated for Western Blot

Specifications

• Antigen: Connexin 31/GJB3
• Classification: Polyclonal
• Dilution: Western Blot 1:2000-1:50000
• Gene Alias: connexin 31, connexin-31, Cx31, CX31MGC102938, DFNA2, DFNA2B, EKV, erythrokeratodermia variabilis, FLJ22486, gap junction beta-3 protein, gap junction protein, beta 3, 31kD (connexin 31), gap junction protein, beta 3, 31kDa, gap junction protein, beta 3, 31kDa (connexin 31)
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Connexin 31/GJB3 (NP_076872.1). ERERRHRQKHGDQCAKLYDNAGKKHGGLWWTYLFSLIFKLIIEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVDCYIARPTEKKIFTYFMVGASAVCIV
• Quantity: 0.02 mL
• Research Discipline: Cell Biology, Cytoskeleton Markers, Neuroscience, Signal Transduction
• Gene ID (Entrez): 2707
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified