Collagen XXI Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18499141	Novus Biologicals NBP1-91015-25ul	25 μL
18347440	Novus Biologicals NBP1-91015	0.1 mL

Description

Collagen XXI Polyclonal specifically detects Collagen XXI in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Collagen XXI
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cytoskeleton Markers, Extracellular Matrix
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: alpha 1 chain-like collagen, alpha 1 type XXI collagen, COL1AL, COLA1L, Collagen 21, collagen alpha-1(XXI) chain, collagen, type XXI, alpha 1, Collagen-21, dJ682J15.1, dJ708F5.1, DKFZp564B052, FLJ39125, FLJ44623, MGC26619
• Gene Symbols: COL21A1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Concentration: 0.05mg/mL
• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: Q96P44
• Gene ID (Entrez): 81578
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AKSSRFLTKIAVVLTDGKSQDDVKDAAQAARDSKITLFAIGVGSETEDAELRAIANKPSSTYVFYVEDYIAISKIREVMK
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only