missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Collagen XXI Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-91015
This item is not returnable.
View return policy
Description
Collagen XXI Polyclonal specifically detects Collagen XXI in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| Collagen XXI | |
| Polyclonal | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| alpha 1 chain-like collagen, alpha 1 type XXI collagen, COL1AL, COLA1L, Collagen 21, collagen alpha-1(XXI) chain, collagen, type XXI, alpha 1, Collagen-21, dJ682J15.1, dJ708F5.1, DKFZp564B052, FLJ39125, FLJ44623, MGC26619 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| 0.05mg/mL | |
| Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml | |
| Q96P44 | |
| COL21A1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:AKSSRFLTKIAVVLTDGKSQDDVKDAAQAARDSKITLFAIGVGSETEDAELRAIANKPSSTYVFYVEDYIAISKIREVMK | |
| 0.1 mL | |
| Cytoskeleton Markers, Extracellular Matrix | |
| 81578 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction