missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Collagen VI alpha 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
£380.00
Specifications
| Antigen | Collagen VI |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18225874
|
Novus Biologicals
NBP1-59126 |
100 μL | |||||||
Description
Collagen VI alpha 1 Polyclonal specifically detects Collagen VI alpha 1 in Human samples. It is validated for Western Blot.Specifications
| Collagen VI | |
| Polyclonal | |
| Rabbit | |
| Cytoskeleton Markers, Extracellular Matrix | |
| Collagen 6, collagen alpha-1(VI) chain, collagen VI, alpha-1 polypeptide, collagen, type VI, alpha 1, Collagen-6, human mRNA for collagen VI alpha-1 C-terminal globular domain10alpha 1 (VI) chain (61 AA), OPLL | |
| COL6A1 | |
| IgG | |
| 108 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P12109 | |
| 1291 | |
| Synthetic peptides corresponding to COL6A1(collagen, type VI, alpha 1) The peptide sequence was selected from the middle region of COL6A1 (NP_001839). Peptide sequence ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title