Collagen VI alpha 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Brand:  Novus Biologicals NBP1-59126

Product Code. 18225874

Description

Collagen VI alpha 1 Polyclonal specifically detects Collagen VI alpha 1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Collagen VI
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Collagen 6, collagen alpha-1(VI) chain, collagen VI, alpha-1 polypeptide, collagen, type VI, alpha 1, Collagen-6, human mRNA for collagen VI alpha-1 C-terminal globular domain10alpha 1 (VI) chain (61 AA), OPLL
• Host Species: Rabbit
• Molecular Weight of Antigen: 108 kDa
• Quantity: 100 μL
• Research Discipline: Cytoskeleton Markers, Extracellular Matrix
• Gene ID (Entrez): 1291
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P12109
• Gene Symbols: COL6A1
• Immunogen: Synthetic peptides corresponding to COL6A1(collagen, type VI, alpha 1) The peptide sequence was selected from the middle region of COL6A1 (NP_001839). Peptide sequence ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Bovine: 92%; Equine: 92%; Mouse: 85%; Rat: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
• Isotype: IgG