missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Collagen IV alpha5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£161.00 - £359.00
Specifications
| Antigen | Collagen IV alpha5 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18398085
|
Novus Biologicals
NBP3-10797-25UL |
25 μg |
£161.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18385984
|
Novus Biologicals
NBP3-10797-100UL |
100 μg |
£359.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Collagen IV alpha5 Polyclonal specifically detects Collagen IV alpha5 in Human samples. It is validated for Western Blot.Specifications
| Collagen IV alpha5 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| alpha-5 polypeptide, Alport syndrome, CA54, collagen of basement membrane, alpha-5 chain, collagen, type IV, alpha 5, dA149D17.3, dA24A23.1, MGC167109, MGC42377 | |
| The immunogen is a synthetic peptide directed towards the middle region of human Collagen IV alpha5 (NP_000486.1). Peptide sequence PGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPGLPGLPGPP | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 1287 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title