Collagen IV alpha5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10797-25UL

Product Code. 18398085

Description

Collagen IV alpha5 Polyclonal specifically detects Collagen IV alpha5 in Human samples. It is validated for Western Blot.

Spécification

• Antigen: Collagen IV alpha5
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: alpha-5 polypeptide, Alport syndrome, CA54, collagen of basement membrane, alpha-5 chain, collagen, type IV, alpha 5, dA149D17.3, dA24A23.1, MGC167109, MGC42377
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Collagen IV alpha5 (NP_000486.1). Peptide sequence PGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPGLPGLPGPP
• Quantity: 25 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1287
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.