missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CNTFR Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | CNTFR |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CNTFR Polyclonal specifically detects CNTFR in Human samples. It is validated for Western Blot.Specifications
| CNTFR | |
| Polyclonal | |
| Rabbit | |
| Growth and Development, Neuronal Cell Markers | |
| ciliary neurotrophic factor receptor, ciliary neurotrophic factor receptor alpha, ciliary neurotrophic factor receptor subunit alpha, CNTF receptor subunit alpha, CNTFR alpha, CNTFR-alpha, MGC1774 | |
| CNTFR | |
| IgG | |
| This product is specific to Subunit or Isoform: alpha. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P26992 | |
| 1271 | |
| Synthetic peptides corresponding to CNTFR (ciliary neurotrophic factor receptor) The peptide sequence was selected from the C terminal of CNTFR. Peptide sequence VAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGG. | |
| Primary | |
| 41 kDa |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto