missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CMG-2/ANTXR2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CMG-2/ANTXR2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CMG-2/ANTXR2 Polyclonal specifically detects CMG-2/ANTXR2 in Mouse samples. It is validated for Western Blot.Specifications
| CMG-2/ANTXR2 | |
| Polyclonal | |
| Rabbit | |
| Q6DFX2 | |
| 118429 | |
| Synthetic peptides corresponding to Antxr2 (anthrax toxin receptor 2) The peptide sequence was selected from the N terminal of Antxr2. Peptide sequence GLVPSYAENEAKKSRSLGASVYCVGVLDFEQAQLERIADSKDQVFPVKGG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| anthrax toxin receptor 2, Capillary morphogenesis gene 2 protein, capillary morphogenesis protein 2, CMG2MGC111533, CMG-2MGC45856, FLJ31074, ISH, JHF | |
| ANTXR2 | |
| IgG | |
| 53 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title