MAU2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56779

Product Code. 18223415

Description

MAU2 Polyclonal specifically detects MAU2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MAU2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cohesin loading complex subunit SCC4 homolog, KIAA0892MAU2 chromatid cohesion factor homolog, MAU-2, MAU2 chromatid cohesion factor homolog (C. elegans), MAU2L, MGC75361, SCC4protein MAU-2, sister chromatid cohesion 4
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23383
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1-3 μg/mL
• Gene Accession No.: Q9Y6X3
• Gene Symbols: MAU2
• Immunogen: Synthetic peptides corresponding to KIAA0892(KIAA0892) The peptide sequence was selected from the middle region of KIAA0892. Peptide sequence MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: SCC4 homolog.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG