missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAU2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£398.00
Specifications
| Antigen | MAU2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MAU2 Polyclonal specifically detects MAU2 in Human samples. It is validated for Western Blot.Specifications
| MAU2 | |
| Polyclonal | |
| Rabbit | |
| Q9Y6X3 | |
| 23383 | |
| Synthetic peptides corresponding to KIAA0892(KIAA0892) The peptide sequence was selected from the middle region of KIAA0892. Peptide sequence MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Cohesin loading complex subunit SCC4 homolog, KIAA0892MAU2 chromatid cohesion factor homolog, MAU-2, MAU2 chromatid cohesion factor homolog (C. elegans), MAU2L, MGC75361, SCC4protein MAU-2, sister chromatid cohesion 4 | |
| MAU2 | |
| IgG | |
| This product is specific to Subunit or Isoform: SCC4 homolog. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title