missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CLN8 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92342-0.02ml
This item is not returnable.
View return policy
Description
CLN8 Polyclonal antibody specifically detects CLN8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| CLN8 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:100 - 1:500, Immunohistochemistry-Paraffin | |
| C8orf61, ceroid-lipofuscinosis, neuronal 8 (epilepsy, progressive with mental retardation), EPMR | |
| A synthetic peptide corresponding to a sequence within amino acids 200-286 of human CLN8 (NP_061764.2). MFHCRMVLTYHMWWVCFWHWDGLVSSLYLPHLTLFLVGLALLTLIINPYWTHKKTQQLLNPVDWNFAQPEAKSRPEGNGQLLRKKRP | |
| 0.02 mL | |
| Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction | |
| 2055 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction