missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CLCN1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CLCN1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CLCN1 Polyclonal specifically detects CLCN1 in Mouse, Rat samples. It is validated for Western Blot.Spécification
| CLCN1 | |
| Polyclonal | |
| Rabbit | |
| chloride channel 1, skeletal muscle, Chloride channel protein, skeletal muscle, clC-1, CLC1chloride channel protein 1, MGC138361, MGC142055 | |
| CLCN1 | |
| IgG | |
| 110 kDa |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| RUO | |
| 1180 | |
| Synthetic peptides corresponding to Clcn1 (chloride channel 1) The peptide sequence was selected from the C terminal of Clcn1. Peptide sequence SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV. | |
| Primary |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit