missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CKII alpha prime polypeptide Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CKII alpha prime polypeptide |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
CKII alpha prime polypeptide Polyclonal specifically detects CKII alpha prime polypeptide in Human samples. It is validated for Western Blot, Immunoprecipitation.Specifications
| CKII alpha prime polypeptide | |
| Unconjugated | |
| RUO | |
| P19784 | |
| 1459 | |
| Synthetic peptides corresponding to CSNK2A2(casein kinase 2, alpha prime polypeptide) The peptide sequence was selected from the C terminal of CSNK2A2. Peptide sequence LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Protein Kinase, Wnt Signaling Pathway | |
| casein kinase 2, alpha prime polypeptide, casein kinase II subunit alpha', CK II alpha', CK2A2, CSNK2A1, EC 2.7.11, EC 2.7.11.1, FLJ43934 | |
| CSNK2A2 | |
| IgG | |
| This product is specific to Subunit or Isoform: alpha'. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title