missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CISH/CIS-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CISH/CIS-1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CISH/CIS-1 Polyclonal specifically detects CISH/CIS-1 in Mouse samples. It is validated for Western Blot.Specifications
| CISH/CIS-1 | |
| Polyclonal | |
| Rabbit | |
| NP_034025 | |
| 1154 | |
| Synthetic peptide directed towards the N terminal of human CishThe immunogen for this antibody is Cish. Peptide sequence RESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CIS-1cytokine-inducible SH2-containing protein, CIScytokine-inducible inhibitor of signaling type 1B, cytokine inducible SH2-containing protein, G18Protein G18, SOCS, Suppressor of cytokine signaling | |
| CISH | |
| IgG | |
| 28 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title