CISH/CIS-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79513

Product Code. 18250096

Description

CISH/CIS-1 Polyclonal specifically detects CISH/CIS-1 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: CISH/CIS-1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CIS-1cytokine-inducible SH2-containing protein, CIScytokine-inducible inhibitor of signaling type 1B, cytokine inducible SH2-containing protein, G18Protein G18, SOCS, Suppressor of cytokine signaling
• Host Species: Rabbit
• Molecular Weight of Antigen: 28 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_034025
• Gene Symbols: CISH
• Immunogen: Synthetic peptide directed towards the N terminal of human CishThe immunogen for this antibody is Cish. Peptide sequence RESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPT.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1154
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
• Isotype: IgG