missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CIB3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CIB3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CIB3 Polyclonal specifically detects CIB3 in Human samples. It is validated for Western Blot.Specifications
| CIB3 | |
| Polyclonal | |
| Rabbit | |
| Q96Q77 | |
| 117286 | |
| Synthetic peptides corresponding to CIB3(calcium and integrin binding family member 3) The peptide sequence was selected from the N terminal of CIB3. Peptide sequence QDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| calcium and integrin binding family member 3, calcium and integrin-binding family member 3, DNA-dependent protein kinase catalytic subunit-interacting protein 3, Kinase-interacting protein 3, KIP 3, KIP3MGC96922, MGC138405, MGC142151 | |
| CIB3 | |
| IgG | |
| 22 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title