CIB3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55314

Product Code. 18276593

Description

CIB3 Polyclonal specifically detects CIB3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CIB3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: calcium and integrin binding family member 3, calcium and integrin-binding family member 3, DNA-dependent protein kinase catalytic subunit-interacting protein 3, Kinase-interacting protein 3, KIP 3, KIP3MGC96922, MGC138405, MGC142151
• Host Species: Rabbit
• Molecular Weight of Antigen: 22 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Guinea pig: 86%; Equine: 75%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96Q77
• Gene Symbols: CIB3
• Immunogen: Synthetic peptides corresponding to CIB3(calcium and integrin binding family member 3) The peptide sequence was selected from the N terminal of CIB3. Peptide sequence QDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 117286
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.