missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Chymotrypsin C/CTRC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Chymotrypsin C/CTRC |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Chymotrypsin C/CTRC Polyclonal specifically detects Chymotrypsin C/CTRC in Human samples. It is validated for Western Blot.Specifications
| Chymotrypsin C/CTRC | |
| Polyclonal | |
| Rabbit | |
| Q99895 | |
| 11330 | |
| Synthetic peptides corresponding to CTRC(chymotrypsin C (caldecrin)) The peptide sequence was selected from the N terminal of CTRC. Peptide sequence LGITVLAALLACASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Caldecrin, chymotrypsin C (caldecrin), chymotrypsin-C, CLCRserum calcium decreasing factor, EC 3.4.21, EC 3.4.21.2, ELA4, elastase 4, elastase IV | |
| CTRC | |
| IgG | |
| 27 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title