Chymotrypsin C/CTRC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP1-58035

Código de producto. 18283201

Descripción

Chymotrypsin C/CTRC Polyclonal specifically detects Chymotrypsin C/CTRC in Human samples. It is validated for Western Blot.

Especificaciones

• Antigen: Chymotrypsin C/CTRC
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Caldecrin, chymotrypsin C (caldecrin), chymotrypsin-C, CLCRserum calcium decreasing factor, EC 3.4.21, EC 3.4.21.2, ELA4, elastase 4, elastase IV
• Host Species: Rabbit
• Molecular Weight of Antigen: 27 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 85%; Mouse: 85%; Bovine: 78%; Rat: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q99895
• Gene Symbols: CTRC
• Immunogen: Synthetic peptides corresponding to CTRC(chymotrypsin C (caldecrin)) The peptide sequence was selected from the N terminal of CTRC. Peptide sequence LGITVLAALLACASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11330
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.