missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CHST13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CHST13 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CHST13 Polyclonal specifically detects CHST13 in Human samples. It is validated for Western Blot.Specifications
| CHST13 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| C4ST-3, C4ST3MGC119279, carbohydrate (chondroitin 4) sulfotransferase 13, carbohydrate sulfotransferase 13, Chondroitin 4-O-sulfotransferase 3, Chondroitin 4-sulfotransferase 3, EC 2.8.2.5, MGC119278, MGC119281 | |
| CHST13 | |
| IgG | |
| 39 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8NET6 | |
| 166012 | |
| Synthetic peptides corresponding to CHST13(carbohydrate (chondroitin 4) sulfotransferase 13) The peptide sequence was selected from the C terminal of CHST13. Peptide sequence CHPCRLRYDVVGKFETLAEDAAFVLGLAGASDLSFPGPPRPRGAAASRDL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title