missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CHN 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CHN 1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CHN 1 Polyclonal specifically detects CHN 1 in Human, Mouse samples. It is validated for Western Blot.Specifications
| CHN 1 | |
| Polyclonal | |
| Rabbit | |
| P15882 | |
| 1123 | |
| Synthetic peptides corresponding to CHN1(chimerin (chimaerin) 1) The peptide sequence was selected from the middle region of CHN1. Peptide sequence KVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| a2-chimaerin, A-chimaerin, alpha-chimerin, ARHGAP2RhoGAP2, chimerin (chimaerin) 1, CHNDuane retraction syndrome 2, DURS2, NC, N-chimaerin, N-chimerin, Rho GTPase-activating protein 2, RHOGAP2 | |
| CHN1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title