CHN 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-58326

Product Code. 18263843

Description

CHN 1 Polyclonal specifically detects CHN 1 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: CHN 1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: a2-chimaerin, A-chimaerin, alpha-chimerin, ARHGAP2RhoGAP2, chimerin (chimaerin) 1, CHNDuane retraction syndrome 2, DURS2, NC, N-chimaerin, N-chimerin, Rho GTPase-activating protein 2, RHOGAP2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1123
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P15882
• Gene Symbols: CHN1
• Immunogen: Synthetic peptides corresponding to CHN1(chimerin (chimaerin) 1) The peptide sequence was selected from the middle region of CHN1. Peptide sequence KVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Xenopus: 92%; Bovine: 92%; Rabbit: 92%; Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG