missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CHMP1B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CHMP1B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CHMP1B Polyclonal specifically detects CHMP1B in Human samples. It is validated for Western Blot.Specifications
| CHMP1B | |
| Polyclonal | |
| Rabbit | |
| Q7LBR1 | |
| 57132 | |
| Synthetic peptides corresponding to CHMP1B(chromatin modifying protein 1B) Antibody(against the N terminal of CHMP1B. Peptide sequence KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C18orf2C10orf2, charged multivesicular body protein 1b, CHMP1.5C18-ORF2, CHMP1b, chromatin modifying protein 1B, Chromatin-modifying protein 1b, hVps46-2, vacuolar protein sorting 46-2, Vacuolar protein sorting-associated protein 46-2, Vps46-2, Vps46B | |
| CHMP1B | |
| IgG | |
| 22 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title