CHMP1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55512

Product Code. 18241525

Description

CHMP1B Polyclonal specifically detects CHMP1B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CHMP1B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C18orf2C10orf2, charged multivesicular body protein 1b, CHMP1.5C18-ORF2, CHMP1b, chromatin modifying protein 1B, Chromatin-modifying protein 1b, hVps46-2, vacuolar protein sorting 46-2, Vacuolar protein sorting-associated protein 46-2, Vps46-2, Vps46B
• Host Species: Rabbit
• Molecular Weight of Antigen: 22 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q7LBR1
• Gene Symbols: CHMP1B
• Immunogen: Synthetic peptides corresponding to CHMP1B(chromatin modifying protein 1B) Antibody(against the N terminal of CHMP1B. Peptide sequence KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57132
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Zebrafish
• Isotype: IgG