missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CHD1L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | CHD1L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
CHD1L Polyclonal specifically detects CHD1L in Human samples. It is validated for Western Blot.Specifications
| CHD1L | |
| Polyclonal | |
| Purified | |
| RUO | |
| ALC1, amplified in liver cancer 1, amplified in liver cancer protein 1, CHDL, chromodomain helicase DNA binding protein 1-like, chromodomain-helicase-DNA-binding protein 1-like, FLJ22530 | |
| CHD1L | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Q9H678 | |
| 9557 | |
| Synthetic peptides corresponding to CHD1L (chromodomain helicase DNA binding protein 1-like) The peptide sequence was selected from the middle region of CHD1L. Peptide sequence DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title