missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CHD1L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-57105
This item is not returnable.
View return policy
Description
CHD1L Polyclonal specifically detects CHD1L in Human samples. It is validated for Western Blot.
Specifications
| CHD1L | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| ALC1, amplified in liver cancer 1, amplified in liver cancer protein 1, CHDL, chromodomain helicase DNA binding protein 1-like, chromodomain-helicase-DNA-binding protein 1-like, FLJ22530 | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 9557 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9H678 | |
| CHD1L | |
| Synthetic peptides corresponding to CHD1L (chromodomain helicase DNA binding protein 1-like) The peptide sequence was selected from the middle region of CHD1L. Peptide sequence DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Canine: 92%; Equine: 92%; Guinea pig: 85%; Chicken: 78%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction