missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CGI-16 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CGI-16 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CGI-16 Polyclonal specifically detects CGI-16 in Human samples. It is validated for Western Blot.Specifications
| CGI-16 | |
| Polyclonal | |
| Rabbit | |
| Q96EA2 | |
| 23597 | |
| Synthetic peptides corresponding to the C terminal of ACOT9. Immunizing peptide sequence FLSSQVCFTQNNYIQVRVHSEVASLQEKQHTTTNVFHFTFMSEKEVPLVF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ACATE2, Acyl-CoA thioester hydrolase 9, acyl-CoA thioesterase 9acyl-Coenzyme A thioesterase 2, mitochondrial, acyl-coenzyme A thioesterase 9, mitochondrial, CGI-16, EC 3.1.2, EC 3.1.2.-, EC 3.1.2.15, mitochondrial Acyl-CoA Thioesterase, MT-ACT48 | |
| ACOT9 | |
| IgG | |
| 23 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title