CGI-16 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-74084

Product Code. 18273692

Description

CGI-16 Polyclonal specifically detects CGI-16 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CGI-16
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ACATE2, Acyl-CoA thioester hydrolase 9, acyl-CoA thioesterase 9acyl-Coenzyme A thioesterase 2, mitochondrial, acyl-coenzyme A thioesterase 9, mitochondrial, CGI-16, EC 3.1.2, EC 3.1.2.-, EC 3.1.2.15, mitochondrial Acyl-CoA Thioesterase, MT-ACT48
• Host Species: Rabbit
• Molecular Weight of Antigen: 23 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Pig: 86%; Horse: 86%; Guinea pig: 86%; Rat: 79%; Bovine: 79%.
• Target Species: Human, Rat, Bovine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96EA2
• Gene Symbols: ACOT9
• Immunogen: Synthetic peptides corresponding to the C terminal of ACOT9. Immunizing peptide sequence FLSSQVCFTQNNYIQVRVHSEVASLQEKQHTTTNVFHFTFMSEKEVPLVF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23597
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.