missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cdc20 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
£161.00 - £383.00
Specifications
| Antigen | Cdc20 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells |
| Applications | ELISA, Immunoprecipitation, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30232965
|
Novus Biologicals
NBP3-33500-20ul |
20 μL |
£161.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30230555
|
Novus Biologicals
NBP3-33500-100ul |
100 μL |
£383.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Cdc20 Monoclonal antibody specifically detects Cdc20 in Human,Rat samples. It is validated for ELISA,Immunoprecipitation,Western BlotSpecifications
| Cdc20 | |
| ELISA, Immunoprecipitation, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 991 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Rat | |
| CDC20 cell division cycle 20 homolog, CDC20 cell division cycle 20 homolog (S. cerevisiae), cell division cycle 20 homolog (S. cerevisiae), cell division cycle protein 20 homolog, MGC102824, p55CDCS. cerevisiae, homolog) | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cdc20 (NP_001246).,, Sequence:, MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQ | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title