missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cdc20 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33500-20ul
This item is not returnable.
View return policy
Description
Cdc20 Monoclonal antibody specifically detects Cdc20 in Human,Rat samples. It is validated for ELISA,Immunoprecipitation,Western Blot
Specifications
| Cdc20 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells | |
| CDC20 cell division cycle 20 homolog, CDC20 cell division cycle 20 homolog (S. cerevisiae), cell division cycle 20 homolog (S. cerevisiae), cell division cycle protein 20 homolog, MGC102824, p55CDCS. cerevisiae, homolog) | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cdc20 (NP_001246).,, Sequence:, MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQ | |
| 20 μL | |
| Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
| 991 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunoprecipitation, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction