missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDC16 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33529-20ul
This item is not returnable.
View return policy
Description
CDC16 Monoclonal antibody specifically detects CDC16 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Specifications
| CDC16 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| ANAPC6subunit 6, CDC16 (cell division cycle 16, S. cerevisiae, homolog), CDC16 cell division cycle 16 homolog (S. cerevisiae), CDC16 homolog, CDC16Hs, cell division cycle 16 homolog (S. cerevisiae), cell division cycle protein 16 homolog, Cyclosome subunit 6 | |
| A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CDC16 (Q13042).,, Sequence:, LLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPV | |
| 20 μL | |
| Cell Biology, Cell Cycle and Replication, Phospho Specific, Ubiquitin Proteasome Pathway | |
| 8881 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction