missing translation for 'onlineSavingsMsg'
Learn More

CDC16 Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

£161.00 - £383.00

Specifications

Antigen	CDC16
Dilution	Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Applications	ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification	Monoclonal
Conjugate	Unconjugated

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
30230592 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP3-33529-20ul	20 μL	£161.00 20µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

30227446 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP3-33529-100ul	100 μL	£383.00 100µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

CDC16 Monoclonal antibody specifically detects CDC16 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence

Specifications

Antigen	CDC16
Applications	ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Cell Biology, Cell Cycle and Replication, Phospho Specific, Ubiquitin Proteasome Pathway
Formulation	PBS (pH 7.3), 50% glycerol, 0.05% BSA
Gene ID (Entrez)	8881
Isotype	IgG
Purification Method	Affinity purified

Dilution	Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human, Mouse, Rat
Gene Alias	ANAPC6subunit 6, CDC16 (cell division cycle 16, S. cerevisiae, homolog), CDC16 cell division cycle 16 homolog (S. cerevisiae), CDC16 homolog, CDC16Hs, cell division cycle 16 homolog (S. cerevisiae), cell division cycle protein 16 homolog, Cyclosome subunit 6
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CDC16 (Q13042).,, Sequence:, LLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPV
Primary or Secondary	Primary
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

CDC16 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents