CD300b/LMIR5/CD300LB Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18390377	Novus Biologicals NBP3-09599-100UL	100 μg

Description

CD300b/LMIR5/CD300LB Polyclonal specifically detects CD300b/LMIR5/CD300LB in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CD300b/LMIR5/CD300LB
• Applications: Western Blot
• Conjugate: Unconjugated
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: CD300 antigen like family member B, CD300 antigen-like family member B, CD300 molecule-like family member b, CD300B, CD300b antigen, CLM-7, CLM7IREM3CD300 molecule like family member b, CMRF35A2, CMRF35-A2, CMRF35-like molecule 7, EC 1.13.11.6, EC 6.3.4.3, Immune receptor expressed on myeloid cells 3, IREM-3, Leukocyte mono-Ig-like receptor 5, LMIR5, TREM-5, TREM5CD300b, Triggering receptor expressed on myeloid cells 5
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CD300b/LMIR5/CD300LB (NP_777552). Peptide sequence CRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDA
• Purification Method: Affinity purified

• Dilution: Western Blot 1.0 ug/ml
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Formulation: PBS buffer, 2% sucrose
• Gene ID (Entrez): 124599
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.