missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CD300b/LMIR5/CD300LB Polyclonal specifically detects CD300b/LMIR5/CD300LB in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | CD300b/LMIR5/CD300LB |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | CD300 antigen like family member B, CD300 antigen-like family member B, CD300 molecule-like family member b, CD300B, CD300b antigen, CLM-7, CLM7IREM3CD300 molecule like family member b, CMRF35A2, CMRF35-A2, CMRF35-like molecule 7, EC 1.13.11.6, EC 6.3.4.3, Immune receptor expressed on myeloid cells 3, IREM-3, Leukocyte mono-Ig-like receptor 5, LMIR5, TREM-5, TREM5CD300b, Triggering receptor expressed on myeloid cells 5 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human CD300b/LMIR5/CD300LB (NP_777552). Peptide sequence CRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDA |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?