missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD3 epsilon Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38520
This item is not returnable.
View return policy
Description
CD3 epsilon Polyclonal specifically detects CD3 epsilon in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| CD3 epsilon | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| P07766 | |
| CD3E | |
| This antibody was developed against a recombinant protein corresponding to amino acids: WSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI | |
| 0.1 mL | |
| Adaptive Immunity, Apoptosis, Cytokine Research, Diabetes Research, Immunology, Innate Immunity, Mesenchymal Stem Cell Markers, Signal Transduction, Stem Cell Lines, Stem Cell Markers | |
| 916 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CD3e antigen, CD3e antigen, epsilon polypeptide (TiT3 complex), CD3e molecule, epsilon (CD3-TCR complex), CD3-epsilon, FLJ18683, T3E, T-cell antigen receptor complex, epsilon subunit of T3, T-cell surface antigen T3/Leu-4 epsilon chain, T-cell surface glycoprotein CD3 epsilon chain, TCRE | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction