CD3 epsilon Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18170199	Novus Biologicals NBP2-38520	0.1 mL
18600376	Novus Biologicals NBP2-38520-25ul	25 μL

Description

CD3 epsilon Polyclonal specifically detects CD3 epsilon in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CD3 epsilon
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Adaptive Immunity, Apoptosis, Cytokine Research, Diabetes Research, Immunology, Innate Immunity, Mesenchymal Stem Cell Markers, Signal Transduction, Stem Cell Lines, Stem Cell Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CD3e antigen, CD3e antigen, epsilon polypeptide (TiT3 complex), CD3e molecule, epsilon (CD3-TCR complex), CD3-epsilon, FLJ18683, T3E, T-cell antigen receptor complex, epsilon subunit of T3, T-cell surface antigen T3/Leu-4 epsilon chain, T-cell surface glycoprotein CD3 epsilon chain, TCRE
• Gene Symbols: CD3E
• Isotype: IgG
• Purification Method: Affinity Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: P07766
• Gene ID (Entrez): 916
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: WSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.