missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD27/TNFRSF7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £435.00
Specifications
| Antigen | CD27/TNFRSF7 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18692476
|
Novus Biologicals
NBP2-38434-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18138917
|
Novus Biologicals
NBP2-38434 |
0.1 mL |
£435.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CD27/TNFRSF7 Polyclonal specifically detects CD27/TNFRSF7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CD27/TNFRSF7 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Immunology, Innate Immunity | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CD27 antigen, CD27 molecule, MGC20393, S152CD27L receptor, T cell activation antigen CD27, T cell activation antigen S152, T14, TNFRSF7T-cell activation antigen CD27, Tp55, Tumor necrosis factor receptor superfamily member 7, tumor necrosis factor receptor superfamily, member 7 | |
| CD27 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P26842 | |
| 939 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: HQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title