missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD27/TNFRSF7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38434
This item is not returnable.
View return policy
Beskrivning
CD27/TNFRSF7 Polyclonal specifically detects CD27/TNFRSF7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifikationer
| CD27/TNFRSF7 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| P26842 | |
| CD27 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: HQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYR | |
| 0.1 mL | |
| Apoptosis, Cancer, Immunology, Innate Immunity | |
| 939 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CD27 antigen, CD27 molecule, MGC20393, S152CD27L receptor, T cell activation antigen CD27, T cell activation antigen S152, T14, TNFRSF7T-cell activation antigen CD27, Tp55, Tumor necrosis factor receptor superfamily member 7, tumor necrosis factor receptor superfamily, member 7 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering