missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCDC70 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | CCDC70 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CCDC70 Polyclonal specifically detects CCDC70 in Human samples. It is validated for Western Blot.Specifications
| CCDC70 | |
| Polyclonal | |
| Rabbit | |
| Q6NSX1 | |
| 83446 | |
| Synthetic peptides corresponding to CCDC70(coiled-coil domain containing 70) The peptide sequence was selected from the middle region of CCDC70. Peptide sequence TFRGKIHAFRGQILGFWEEERPFWEEEKTFWKEEKSFWEMEKSFREEEKT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| coiled-coil domain containing 70, coiled-coil domain-containing protein 70, DKFZP434K1172, FLJ25853 | |
| CCDC70 | |
| IgG | |
| 26 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title