CCDC70 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55305

Product Code. 18244481

Description

CCDC70 Polyclonal specifically detects CCDC70 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CCDC70
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: coiled-coil domain containing 70, coiled-coil domain-containing protein 70, DKFZP434K1172, FLJ25853
• Host Species: Rabbit
• Molecular Weight of Antigen: 26 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6NSX1
• Gene Symbols: CCDC70
• Immunogen: Synthetic peptides corresponding to CCDC70(coiled-coil domain containing 70) The peptide sequence was selected from the middle region of CCDC70. Peptide sequence TFRGKIHAFRGQILGFWEEERPFWEEEKTFWKEEKSFWEMEKSFREEEKT.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 83446
• Target Species: Human, Mouse, Rat, Pig, Canine, Equine
• Isotype: IgG