missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCDC172 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£391.00
Specifications
| Antigen | CCDC172 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CCDC172 Polyclonal specifically detects CCDC172 in Human samples. It is validated for Western Blot.Specifications
| CCDC172 | |
| Polyclonal | |
| Rabbit | |
| P0C7W6 | |
| 374355 | |
| Synthetic peptides corresponding to CCDC172 The peptide sequence was selected from the middle region of CCDC172. Peptide sequence QANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENES. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C10orf96, chromosome 10 open reading frame 96, hypothetical protein LOC374355, MGC35062 | |
| CCDC172 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title