CCDC172 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56323

Product Code. 18293453

Description

CCDC172 Polyclonal specifically detects CCDC172 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CCDC172
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C10orf96, chromosome 10 open reading frame 96, hypothetical protein LOC374355, MGC35062
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 374355
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P0C7W6
• Gene Symbols: CCDC172
• Immunogen: Synthetic peptides corresponding to CCDC172 The peptide sequence was selected from the middle region of CCDC172. Peptide sequence QANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENES.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Pig: 92%; Canine: 85%; Guinea pig: 85%; Rabbit: 85%.
• Target Species: Human, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast
• Isotype: IgG