missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCDC170 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-37860-25ul
This item is not returnable.
View return policy
Description
CCDC170 Polyclonal antibody specifically detects CCDC170 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| CCDC170 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Q8IYT3 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 80129 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| bA282P11.1, C6orf97, chromosome 6 open reading frame 97, coiled-coil domain containing 170, FLJ23305, hypothetical protein LOC80129 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGVLRDNLNFEKQKYLKFLDQLSQKMKLDQMA | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction