CCDC144NL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57054

Product Code. 18278372

Description

CCDC144NL Polyclonal specifically detects CCDC144NL in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CCDC144NL
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: coiled-coil domain containing 144 family, N-terminal like, MGC87631, putative coiled-coil domain-containing protein 144 N-terminal-like
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 339184
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6NUI1
• Gene Symbols: CCDC144NL
• Immunogen: Synthetic peptides corresponding to MGC87631 (coiled-coil domain containing 144 family, N-terminal like) The peptide sequence was selected from the middle region of MGC87631. Peptide sequence VDKRDRKKSIQQLVPEYKEKQTPESLPQNNNPAAPSQAEGGEGGVACGTV The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.