CBR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Product Code	Brand	Quantity
18494251	Novus Biologicals NBP1-86595-25ul	25 μL
18284587	Novus Biologicals NBP1-86595	0.1 mL

Description

CBR1 Polyclonal specifically detects CBR1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CBR1
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 15-hydroxyprostaglandin dehydrogenase [NADP+], carbonyl reductase (NADPH) 1, carbonyl reductase (NADPH) 1, EC 1.1.1.18410EC 1.1.1.197,15-hydroxyprostaglandin dehydrogenase, carbonyl reductase [NADPH] 1, carbonyl reductase 1, CBR, CRN, EC 1.1.1.184, EC 1.1.1.189, hCBR1, NADPH-dependent carbonyl reductase 1, Prostaglandin 9-ketoreductase, Prostaglandin-E(2) 9-reductase, SDR21C1, short chain dehydrogenase/reductase family 21C, member 1
• Gene Symbols: CBR1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of human CBR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Stem Cell Markers
• Gene Accession No.: P16152
• Gene ID (Entrez): 873
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Molecular Weight of Antigen: 30 kDa

For Research Use Only