missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CATSPERE Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-37849
This item is not returnable.
View return policy
Description
CATSPERE Polyclonal specifically detects CATSPERE in Human samples. It is validated for Western Blot.
Specifications
| C1orf101 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| C1orf101 | |
| The immunogen for Anti-CA101 antibody is: synthetic peptide directed towards the N-terminal region of Human CA101.. Peptide sequence: CFLWYYRVRHFFNNFTQLITVWAYDPESADPDELLGNAEEPSINSIVLST | |
| Affinity purified | |
| RUO | |
| 257044 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q5SY80.2 | |
| Rabbit | |
| 91 kDa | |
| 100 μL | |
| Primary | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction